SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoN4EE50871_5prime_partial:A_BomoN4EE_TR100307_c0_g1_i1
Scaffold_idBomo_Chr24
NCBI non-redundant
(nr)		PREDICTED:_glutamate_receptor_ionotropic,_kainate_3_[Bombyx_mori]
Ontology
GO:0004872 F signaling receptor activity
GO:0004970 F ionotropic glutamate receptor activity
GO:0005216 F ion channel activity
GO:0005234 F extracellularly glutamate-gated ion channel activity
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0007268 P chemical synaptic transmission
GO:0007399 P nervous system development
GO:0008144 F obsolete drug binding
GO:0008328 C ionotropic glutamate receptor complex
GO:0015277 F kainate selective glutamate receptor activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016595 F glutamate binding
GO:0022843 F voltage-gated cation channel activity
GO:0030054 C cell junction
GO:0030425 C dendrite
GO:0032229 P negative regulation of synaptic transmission, GABAergic
GO:0032230 P positive regulation of synaptic transmission, GABAergic
GO:0034220 P ion transmembrane transport
GO:0034765 P regulation of ion transmembrane transport
GO:0035235 P ionotropic glutamate receptor signaling pathway
GO:0042803 F protein homodimerization activity
GO:0043025 C neuronal cell body
GO:0043195 C terminal bouton
GO:0043235 C receptor complex
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0048167 P regulation of synaptic plasticity
GO:0048172 P regulation of short-term neuronal synaptic plasticity
GO:0051967 P negative regulation of synaptic transmission, glutamatergic
RNA-seq EntryA_BomoN4EE_TR100307_c0_g1_i1
Sequence
(Amino Acid)
RNCNLTEVGELFAEQPYAIAVQQGSRLQEDISRALLELQKERFLEQLASKYWNETLRQSC
SDADESEGITLESLGGVFIATLFGLGLAMITLAWEVFYYKRKEKNKVQSKKENVERPPIK
SAKLGGKMAVGVARLRKRATKIGKKKNVTIGDSFKPSVSYISVYPKGDYRP
*(56 a.a.)

- SilkBase 1999-2023 -