SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoN4EE50852_internal:A_BomoN4EE_TR100279_c0_g1_i1
Scaffold_idBomo_Chr14
NCBI non-redundant
(nr)		PREDICTED:_apoptosis-inducing_factor_1,_mitochondrial-like_[Bombyx_mori]
Ontology
GO:0002931 P response to ischemia
GO:0003674 F molecular_function
GO:0003677 F DNA binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005743 C mitochondrial inner membrane
GO:0005758 C mitochondrial intermembrane space
GO:0005829 C cytosol
GO:0006915 P apoptotic process
GO:0006919 P activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0009636 P response to toxic substance
GO:0010942 P positive regulation of cell death
GO:0016020 C membrane
GO:0016174 F NAD(P)H oxidase H2O2-forming activity
GO:0016491 F oxidoreductase activity
GO:0016651 F oxidoreductase activity, acting on NAD(P)H
GO:0030182 P neuron differentiation
GO:0032981 P mitochondrial respiratory chain complex I assembly
GO:0043525 P positive regulation of neuron apoptotic process
GO:0045454 P cell redox homeostasis
GO:0046983 F protein dimerization activity
GO:0048471 C perinuclear region of cytoplasm
GO:0050660 F flavin adenine dinucleotide binding
GO:0051402 P neuron apoptotic process
GO:0055114 P obsolete oxidation-reduction process
GO:0070059 P intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
GO:0070301 P cellular response to hydrogen peroxide
GO:0071392 P cellular response to estradiol stimulus
GO:0071732 P cellular response to nitric oxide
GO:0071949 F FAD binding
GO:0090650 P cellular response to oxygen-glucose deprivation
GO:1902065 P response to L-glutamate
GO:1902510 P regulation of apoptotic DNA fragmentation
GO:1904045 P cellular response to aldosterone
RNA-seq EntryA_BomoN4EE_TR100279_c0_g1_i1
Sequence
(Amino Acid)
RTLRTADDVTQLAARLAGGDVQRVAVLGGGLLATELSAALAARLKDTGKTVLELYRESSP
LASILPSYLAEEAARRLQEAGVTLLPEADVVDSIVVDDKVLMRLASGAEVEADYVVECVG
TEFDPALADASELEVHPELGGVVVNPELQARPRVWAAGSAACHWAPREGRRRGGLHDHAV
TSGRRAGDNMLADMLGTAPAPYTHPHMFWTDLGPDLGYEAIGTIDSKLKTVGVFSEDAVT
ELRAHAAAAGEG
(83 a.a.)

- SilkBase 1999-2023 -