SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoN4EE50821_complete:A_BomoN4EE_TR100202_c0_g2_i1
Scaffold_idBomo_Chr18
NCBI non-redundant
(nr)		PREDICTED:_glycogen_synthase_kinase-3_beta_isoform_X3_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000320 P re-entry into mitotic cell cycle
GO:0001085 F RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001837 P epithelial to mesenchymal transition
GO:0001954 P positive regulation of cell-matrix adhesion
GO:0002039 F p53 binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005178 F integrin binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005813 C centrosome
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005975 P carbohydrate metabolic process
GO:0005977 P glycogen metabolic process
GO:0006349 P regulation of gene expression by genomic imprinting
GO:0006468 P protein phosphorylation
GO:0006611 P protein export from nucleus
GO:0006983 P ER overload response
GO:0007010 P cytoskeleton organization
GO:0007163 P establishment or maintenance of cell polarity
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007409 P axonogenesis
GO:0007520 P myoblast fusion
GO:0007568 P aging
GO:0007623 P circadian rhythm
GO:0008013 F beta-catenin binding
GO:0008134 F transcription factor binding
GO:0008283 P cell population proliferation
GO:0009887 P animal organ morphogenesis
GO:0009968 P negative regulation of signal transduction
GO:0010226 P response to lithium ion
GO:0010614 P negative regulation of cardiac muscle hypertrophy
GO:0010800 P positive regulation of peptidyl-threonine phosphorylation
GO:0010918 P positive regulation of mitochondrial membrane potential
GO:0010975 P regulation of neuron projection development
GO:0010977 P negative regulation of neuron projection development
GO:0014043 P negative regulation of neuron maturation
GO:0014823 P response to activity
GO:0014902 P myotube differentiation
GO:0016020 C membrane
GO:0016055 P Wnt signaling pathway
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016477 P cell migration
GO:0016740 F transferase activity
GO:0018105 P peptidyl-serine phosphorylation
GO:0018107 P peptidyl-threonine phosphorylation
GO:0019901 F protein kinase binding
GO:0021766 P hippocampus development
GO:0030010 P establishment of cell polarity
GO:0030154 P cell differentiation
GO:0030424 C axon
GO:0030425 C dendrite
GO:0030426 C growth cone
GO:0030516 P regulation of axon extension
GO:0030529 C ribonucleoprotein complex
GO:0030877 C beta-catenin destruction complex
GO:0031333 P negative regulation of protein-containing complex assembly
GO:0031334 P positive regulation of protein-containing complex assembly
GO:0031625 F ubiquitin protein ligase binding
GO:0032091 P negative regulation of protein binding
GO:0032092 P positive regulation of protein binding
GO:0032355 P response to estradiol
GO:0032436 P positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032868 P response to insulin
GO:0032886 P regulation of microtubule-based process
GO:0033138 P positive regulation of peptidyl-serine phosphorylation
GO:0034236 F protein kinase A catalytic subunit binding
GO:0034392 P negative regulation of smooth muscle cell apoptotic process
GO:0035255 F ionotropic glutamate receptor binding
GO:0035372 P protein localization to microtubule
GO:0035556 P intracellular signal transduction
GO:0035729 P cellular response to hepatocyte growth factor stimulus
GO:0036016 P cellular response to interleukin-3
GO:0036018 P cellular response to erythropoietin
GO:0042493 P response to xenobiotic stimulus
GO:0043025 C neuronal cell body
GO:0043065 P positive regulation of apoptotic process
GO:0043066 P negative regulation of apoptotic process
GO:0043197 C dendritic spine
GO:0043198 C dendritic shaft
GO:0043227 C membrane-bounded organelle
GO:0043234 C protein-containing complex
GO:0043407 P negative regulation of MAP kinase activity
GO:0043525 P positive regulation of neuron apoptotic process
GO:0043547 P positive regulation of GTPase activity
GO:0044027 P hypermethylation of CpG island
GO:0044297 C cell body
GO:0044337 P canonical Wnt signaling pathway involved in positive regulation of apoptotic process
GO:0045121 C membrane raft
GO:0045444 P fat cell differentiation
GO:0045732 P positive regulation of protein catabolic process
GO:0045773 P positive regulation of axon extension
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046777 P protein autophosphorylation
GO:0046827 P positive regulation of protein export from nucleus
GO:0048156 F tau protein binding
GO:0048168 P regulation of neuronal synaptic plasticity
GO:0048471 C perinuclear region of cytoplasm
GO:0048511 P rhythmic process
GO:0048661 P positive regulation of smooth muscle cell proliferation
GO:0048814 P regulation of dendrite morphogenesis
GO:0050321 F tau-protein kinase activity
GO:0050770 P regulation of axonogenesis
GO:0050774 P negative regulation of dendrite morphogenesis
GO:0051001 P negative regulation of nitric-oxide synthase activity
GO:0051059 F NF-kappaB binding
GO:0051534 P negative regulation of calcineurin-NFAT signaling cascade
GO:0060070 P canonical Wnt signaling pathway
GO:0070059 P intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
GO:0070301 P cellular response to hydrogen peroxide
GO:0071109 P superior temporal gyrus development
GO:0071260 P cellular response to mechanical stimulus
GO:0071282 P cellular response to iron(II) ion
GO:0071285 P cellular response to lithium ion
GO:0071871 P response to epinephrine
GO:0097192 P extrinsic apoptotic signaling pathway in absence of ligand
GO:0097481 C postsynaptic density
GO:1901030 P positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway
GO:1901216 P positive regulation of neuron death
GO:1902065 P response to L-glutamate
GO:1903351 P cellular response to dopamine
GO:1904339 P negative regulation of dopaminergic neuron differentiation
GO:1990418 P response to insulin-like growth factor stimulus
GO:1990478 P response to ultrasound
GO:1990776 P response to angiotensin
GO:1990909 C Wnt signalosome
GO:2000171 P negative regulation of dendrite development
GO:2000463 P positive regulation of excitatory postsynaptic potential
GO:2000573 P positive regulation of DNA biosynthetic process
GO:2000738 P positive regulation of stem cell differentiation
GO:2001223 P negative regulation of neuron migration
RNA-seq EntryA_BomoN4EE_TR100202_c0_g2_i1
Sequence
(Amino Acid)
MSGRPRTTSFAEGSKSVRKTFDNQPPKPPLGGVKISSKDGSKVTTVVATPGQGPDRPQEV
SYADMKLIGNGSFGVVYQAKLCDTGELIAIKKVLQDKRFKNRELQIMRRLEHCNIVKLKY
FFYSSGEKKDEVYLNLVLEYIPETVYKVARHYSKDEQTIPISFIKLYMYQLFRSLAYIHS
LGICHRDIKPQNLLLDPKTGVLKLCDFGSAKHLVRGEPNVSYICSRYYRAPELIFGATDY
TTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFP
QIKSHPWAKVFRACTPPDAISLVSRLLEYTPGARLSPLQACVHSFFDELREPTARLPNGR
PLPPLFNFTEYELGIQPSLNEFLKPRSAAQSEPAAASSAPDHDAPGEAASGGATADAS
*(138 a.a.)

- SilkBase 1999-2023 -