SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoN4EE50806_complete:A_BomoN4EE_TR100160_c0_g1_i1
Scaffold_idBomo_Chr17
NCBI non-redundant
(nr)		putative_VPS9-ankyrin_repeat-containing_protein_[Bombyx_mori]
Ontology
GO:0000149 F SNARE binding
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005096 F GTPase activator activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005764 C lysosome
GO:0005768 C endosome
GO:0005769 C early endosome
GO:0005770 C late endosome
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0017137 F small GTPase binding
GO:0030133 C transport vesicle
GO:0030659 C cytoplasmic vesicle membrane
GO:0031410 C cytoplasmic vesicle
GO:0035544 P negative regulation of SNARE complex assembly
GO:0035646 P endosome to melanosome transport
GO:0042470 C melanosome
GO:0043005 C neuron projection
GO:0043547 P positive regulation of GTPase activity
GO:0045022 P early endosome to late endosome transport
GO:0048812 P neuron projection morphogenesis
GO:0050775 P positive regulation of dendrite morphogenesis
GO:0097422 C tubular endosome
GO:1990126 P endocytic recycling
RNA-seq EntryA_BomoN4EE_TR100160_c0_g1_i1
Sequence
(Amino Acid)
MDGTYDEIVSENPFFLELKNEYANLFQHCLSESWIICVPRIGSLTSRVFTVEDFCAHLLV
PSDELPETHFNTLTEKQVTVLNKVITVEVSKGLPLQSHILFEETFYTEDFMKYKVWCIES
PLEPTKTTDDAVVSKEYLSGINDCIDLLWTQAAGRQVLDNIEQNVETFFEETF
*(57 a.a.)

- SilkBase 1999-2023 -