SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoN4EE50775_complete:A_BomoN4EE_TR100131_c0_g1_i2
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)		PREDICTED:_ubiquitin_carboxyl-terminal_hydrolase_CYLD_isoform_X1_[Bombyx_mori]
Ontology
GO:0004843 F thiol-dependent deubiquitinase
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005819 C spindle
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0005881 C cytoplasmic microtubule
GO:0005886 C plasma membrane
GO:0006508 P proteolysis
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0007049 P cell cycle
GO:0007346 P regulation of mitotic cell cycle
GO:0008233 F peptidase activity
GO:0008234 F cysteine-type peptidase activity
GO:0008270 F zinc ion binding
GO:0010803 P regulation of tumor necrosis factor-mediated signaling pathway
GO:0016020 C membrane
GO:0016055 P Wnt signaling pathway
GO:0016579 P protein deubiquitination
GO:0016787 F hydrolase activity
GO:0019901 F protein kinase binding
GO:0030496 C midbody
GO:0031234 C extrinsic component of cytoplasmic side of plasma membrane
GO:0032088 P negative regulation of NF-kappaB transcription factor activity
GO:0032480 P negative regulation of type I interferon production
GO:0036064 C ciliary basal body
GO:0036459 F thiol-dependent deubiquitinase
GO:0042347 P negative regulation of NIK/NF-kappaB signaling
GO:0042995 C cell projection
GO:0045581 P negative regulation of T cell differentiation
GO:0046872 F metal ion binding
GO:0048471 C perinuclear region of cytoplasm
GO:0061578 F Lys63-specific deubiquitinase activity
GO:0070064 F proline-rich region binding
GO:0070266 P necroptotic process
GO:0070423 P nucleotide-binding oligomerization domain containing signaling pathway
GO:0070507 P regulation of microtubule cytoskeleton organization
GO:0070536 P protein K63-linked deubiquitination
GO:0090090 P negative regulation of canonical Wnt signaling pathway
GO:0097542 C ciliary tip
GO:1901026 P ripoptosome assembly involved in necroptotic process
GO:1902017 P regulation of cilium assembly
GO:2001238 P positive regulation of extrinsic apoptotic signaling pathway
GO:2001242 P regulation of intrinsic apoptotic signaling pathway
RNA-seq EntryA_BomoN4EE_TR100131_c0_g1_i2
Sequence
(Amino Acid)
MFTFTSVFDALLYRPPEPEDSPHYSEVQRVLREEIVNPLRKHGYVRADRVMKLRTLLERL
SDVPGLTSEEKDPEEFLNGLVAQILRAEPFLKLSSGQEAFCYQLFVEKDEHVSLPTVQQL
LEQSFATSGVKLSEVPAAFIIQMPRFGKQYKLYQRVMPSPLLDVTDLIEGLPRQCAVCGG
LARWECAECARGAALDAAALCRACLRRAHSTRQHKATPLTVFEEYSSILESCPVPRVYME
LFAVLCIETSHYVAFVKAGVGHDAPWCFFDSMADRKGERDGYNIPEIVSMKEVGAWLSEA
DPAPRAPPLARRLLADAYMCFYRSPDVAMYR
*(109 a.a.)

- SilkBase 1999-2023 -