SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoN4EE12911_complete:A_BomoN4EE_TR30572_c0_g4_i1
Scaffold_idBomo_Chr12
NCBI non-redundant
(nr)
Down_syndrome_cell_adhesion_molecule-like_protein_CG42256_[Papilio_xuthus]
Ontology
GO:0000166 F nucleotide binding
GO:0000794 C condensed nuclear chromosome
GO:0002020 F protease binding
GO:0002576 P platelet degranulation
GO:0003300 P cardiac muscle hypertrophy
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005516 F calmodulin binding
GO:0005524 F ATP binding
GO:0005576 C extracellular region
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005859 C muscle myosin complex
GO:0005865 C striated muscle thin filament
GO:0006468 P protein phosphorylation
GO:0006936 P muscle contraction
GO:0006941 P striated muscle contraction
GO:0007076 P mitotic chromosome condensation
GO:0008307 F structural constituent of muscle
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0019899 F enzyme binding
GO:0019901 F protein kinase binding
GO:0030018 C Z disc
GO:0030049 P muscle filament sliding
GO:0030240 P skeletal muscle thin filament assembly
GO:0030241 P skeletal muscle myosin thick filament assembly
GO:0031430 C M band
GO:0031433 F telethonin binding
GO:0031674 C I band
GO:0035995 P detection of muscle stretch
GO:0042802 F identical protein binding
GO:0042805 F actinin binding
GO:0043621 F protein self-association
GO:0045214 P sarcomere organization
GO:0045859 P regulation of protein kinase activity
GO:0046872 F metal ion binding
GO:0048739 P cardiac muscle cell development
GO:0048769 P sarcomerogenesis
GO:0050790 P regulation of catalytic activity
GO:0051015 F actin filament binding
GO:0051371 F muscle alpha-actinin binding
GO:0051592 P response to calcium ion
GO:0055003 P cardiac myofibril assembly
GO:0055008 P cardiac muscle tissue morphogenesis
GO:0060048 P cardiac muscle contraction
GO:0070062 C extracellular exosome
GO:0097493 F structural molecule activity conferring elasticity
RNA-seq EntryA_BomoN4EE_TR30572_c0_g4_i1
Sequence
(Amino Acid)
MCSSLLTIFTVAPIISPFEFDEAVFYGESIQIMCHIPKGDMPLVLTWSFRNEPIKKNDNI
VITKVGHRSAILSIPAATERHSGNYTCTASNTVASTNHTAMLNVQGTFLIMFYCVLIFFL
LNLPLPVPPHIVPLVTEELVFAGESVQLNCHVSKGDQPLTITWSFHGKELSSHQGISTMK
IGQRTSLLTISSATASHSGEYSCHAFNHAGQTVHSTVINVHGIPIVS
*(75 a.a.)

- SilkBase 1999-2023 -