SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoN4EE12828_internal:A_BomoN4EE_TR30508_c0_g1_i1
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)
PREDICTED:_uncharacterized_protein_LOC101745789_isoform_X2_[Bombyx_mori]
Ontology
GO:0001530 F lipopolysaccharide binding
GO:0002376 P immune system process
GO:0002448 P mast cell mediated immunity
GO:0003823 F antigen binding
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005578 C extracellular matrix
GO:0005615 C extracellular space
GO:0007155 P cell adhesion
GO:0008228 P opsonization
GO:0032496 P response to lipopolysaccharide
GO:0032755 P positive regulation of interleukin-6 production
GO:0032760 P positive regulation of tumor necrosis factor production
GO:0042742 P defense response to bacterium
GO:0043152 P induction of bacterial agglutination
GO:0045087 P innate immune response
GO:0046872 F metal ion binding
GO:0050832 P defense response to fungus
GO:0051607 P defense response to virus
GO:0060907 P positive regulation of macrophage cytokine production
GO:0070062 C extracellular exosome
GO:0071222 P cellular response to lipopolysaccharide
RNA-seq EntryA_BomoN4EE_TR30508_c0_g1_i1
Sequence
(Amino Acid)
RPKAQWSQVFGQSHNSNYRLYRLGEVARATVREFAQFGKIDDLVNESDEEPKVYDQFSAP
AIKSGEGETENMVFVDGGHSLVSLICRLIPSPDWFVGVDS
(32 a.a.)

- SilkBase 1999-2023 -