SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoN4EE12762_3prime_partial:A_BomoN4EE_TR30383_c0_g1_i1
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)		PREDICTED:_coiled-coil_and_C2_domain-containing_protein_2A_[Bombyx_mori]
Ontology
GO:0001843 P neural tube closure
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0005929 C cilium
GO:0007224 P smoothened signaling pathway
GO:0007368 P determination of left/right symmetry
GO:0007507 P heart development
GO:0030030 P cell projection organization
GO:0035058 P non-motile cilium assembly
GO:0035082 P axoneme assembly
GO:0035869 C ciliary transition zone
GO:0036038 C MKS complex
GO:0042384 P cilium assembly
GO:0042995 C cell projection
GO:0043010 P camera-type eye development
GO:0044458 P motile cilium assembly
GO:0060271 P cilium assembly
GO:1903887 P motile cilium assembly
GO:1904491 P protein localization to ciliary transition zone
GO:1990403 P embryonic brain development
RNA-seq EntryA_BomoN4EE_TR30383_c0_g1_i1
Sequence
(Amino Acid)
MLYGTQLDHSILLASYFLHLNIKYWVAIGFGLPRGSSSYVLIQYDVKTKRIVQRDDVLKS
GFFVKNEYVLYACDAACGHAWDVRDDACPMKTVQYVFDDRNIW
(33 a.a.)

- SilkBase 1999-2023 -