SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoN4EE12626_complete:A_BomoN4EE_TR30123_c1_g1_i4
Scaffold_idBomo_Chr12
NCBI non-redundant
(nr)
PREDICTED:_synaptotagmin_1_isoform_X1_[Amyelois_transitella]
Ontology
GO:0000149 F SNARE binding
GO:0001786 F phosphatidylserine binding
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005544 F calcium-dependent phospholipid binding
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006887 P exocytosis
GO:0007268 P chemical synaptic transmission
GO:0007269 P neurotransmitter secretion
GO:0007317 P regulation of pole plasm oskar mRNA localization
GO:0008021 C synaptic vesicle
GO:0008345 P larval locomotory behavior
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016079 P synaptic vesicle exocytosis
GO:0016192 P vesicle-mediated transport
GO:0017158 P regulation of calcium ion-dependent exocytosis
GO:0019905 F syntaxin binding
GO:0030054 C cell junction
GO:0030276 F clathrin binding
GO:0030285 C integral component of synaptic vesicle membrane
GO:0030672 C synaptic vesicle membrane
GO:0031340 P positive regulation of vesicle fusion
GO:0031410 C cytoplasmic vesicle
GO:0031594 C neuromuscular junction
GO:0042803 F protein homodimerization activity
GO:0043195 C terminal bouton
GO:0045202 C synapse
GO:0046872 F metal ion binding
GO:0048488 P synaptic vesicle endocytosis
GO:0048489 P synaptic vesicle transport
GO:0048791 P calcium ion-regulated exocytosis of neurotransmitter
GO:0050803 P regulation of synapse structure or activity
GO:0060024 P rhythmic synaptic transmission
GO:1900073 P regulation of neuromuscular synaptic transmission
RNA-seq EntryA_BomoN4EE_TR30123_c1_g1_i4
Sequence
(Amino Acid)
MLHTTTDPYVKIALMQNGKRLKKKKTSIKKCTLNPYYNESFTFEVPFEQIQKVNLVITVV
DYDRIGTSEPIGKVVLGYNASGTELRHWSDMLASPRRPIAQWHTLKDPDDGEKKD
*(37 a.a.)

- SilkBase 1999-2023 -