SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoN4EE125_internal:A_BomoN4EE_TR2074_c0_g1_i1
Scaffold_idBomo_Chr18
NCBI non-redundant
(nr)		PREDICTED:_insulin-like_peptide_receptor_[Papilio_polytes]
Ontology
GO:0000003 P reproduction
GO:0000166 F nucleotide binding
GO:0002376 P immune system process
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004714 F transmembrane receptor protein tyrosine kinase activity
GO:0005009 F insulin-activated receptor activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005975 P carbohydrate metabolic process
GO:0006468 P protein phosphorylation
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007275 P multicellular organism development
GO:0008286 P insulin receptor signaling pathway
GO:0008340 P determination of adult lifespan
GO:0010628 P positive regulation of gene expression
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0017046 F peptide hormone binding
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0019901 F protein kinase binding
GO:0030424 C axon
GO:0030536 P larval feeding behavior
GO:0031410 C cytoplasmic vesicle
GO:0031513 C non-motile cilium
GO:0040018 P positive regulation of multicellular organism growth
GO:0040024 P dauer larval development
GO:0040034 P regulation of development, heterochronic
GO:0042169 F SH2 domain binding
GO:0042992 P obsolete negative regulation of transcription factor import into nucleus
GO:0043025 C neuronal cell body
GO:0043053 P dauer entry
GO:0043054 P dauer exit
GO:0044214 C spanning component of plasma membrane
GO:0045087 P innate immune response
GO:0046777 P protein autophosphorylation
GO:0046872 F metal ion binding
GO:0051425 F PTB domain binding
GO:0061065 P regulation of dauer larval development
GO:1901031 P regulation of response to reactive oxygen species
GO:1903998 P regulation of eating behavior
GO:2000785 P regulation of autophagosome assembly
RNA-seq EntryA_BomoN4EE_TR2074_c0_g1_i1
Sequence
(Amino Acid)
VYINGSLTIHLGSLIEAMTELRTFLSRIEVISEYLVIYSSSTVTSLDFLSSLRRIKGNKL
VGEKFSLVIHDMINLHSLFNVNVSKNLQIDHGTYQMFNNPLLCMSHIDKIKDLFPEEPAE
EDVIQGTNGYGGNCEEASVDIQIQVVNETCAVVMFSPLPDP
(52 a.a.)

- SilkBase 1999-2023 -