SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoN4EE12378_3prime_partial:A_BomoN4EE_TR30094_c0_g2_i1
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)		PREDICTED:_prion-like-(Q/N-rich)_domain-bearing_protein_25_[Bombyx_mori]
Ontology
GO:0003824 F catalytic activity
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005887 C integral component of plasma membrane
GO:0007156 P homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007165 P signal transduction
GO:0007275 P multicellular organism development
GO:0007411 P axon guidance
GO:0010976 P positive regulation of neuron projection development
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030154 P cell differentiation
GO:0031643 P positive regulation of myelination
GO:0032289 P central nervous system myelin formation
GO:0042803 F protein homodimerization activity
GO:0042995 C cell projection
GO:0043005 C neuron projection
GO:0046982 F protein heterodimerization activity
GO:0048666 P neuron development
GO:0048714 P positive regulation of oligodendrocyte differentiation
GO:0097264 P self proteolysis
GO:2000543 P positive regulation of gastrulation
RNA-seq EntryA_BomoN4EE_TR30094_c0_g2_i1
Sequence
(Amino Acid)
MGGWQLIFVALLGLATAQGPEKRRTGNVCNVDMDCPDNAFCRLNSYCVCKEGYVYAAINS
TNKGCLKEARNGEACVQNIQCHMTMGVHSECTGGSCACAPTAHLDGERCYETALIGERCV
VDQNCYLGEQGIERQAFCVRGYCTCQLQFSPRDNGTRSVFFFFVPLANNKAR
(56 a.a.)

- SilkBase 1999-2023 -