SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoN4EE1235_internal:A_BomoN4EE_TR17114_c0_g1_i1
Scaffold_idBomo_Chr18
NCBI non-redundant
(nr)		PREDICTED:_delta-like_protein_1_[Bombyx_mori]
Ontology
GO:0001701 P in utero embryonic development
GO:0001756 P somitogenesis
GO:0001757 P somite specification
GO:0001947 P heart looping
GO:0002315 P marginal zone B cell differentiation
GO:0003323 P type B pancreatic cell development
GO:0005112 F Notch binding
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005886 C plasma membrane
GO:0005912 C adherens junction
GO:0007154 P cell communication
GO:0007219 P Notch signaling pathway
GO:0007220 P Notch receptor processing
GO:0007267 P cell-cell signaling
GO:0007275 P multicellular organism development
GO:0007368 P determination of left/right symmetry
GO:0007386 P compartment pattern specification
GO:0007399 P nervous system development
GO:0008217 P regulation of blood pressure
GO:0008284 P positive regulation of cell population proliferation
GO:0008285 P negative regulation of cell population proliferation
GO:0009887 P animal organ morphogenesis
GO:0009912 P auditory receptor cell fate commitment
GO:0009954 P proximal/distal pattern formation
GO:0010628 P positive regulation of gene expression
GO:0014002 P astrocyte development
GO:0014807 P regulation of somitogenesis
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016324 C apical plasma membrane
GO:0021510 P spinal cord development
GO:0021688 P cerebellar molecular layer formation
GO:0021693 P cerebellar Purkinje cell layer structural organization
GO:0030054 C cell junction
GO:0030154 P cell differentiation
GO:0030155 P regulation of cell adhesion
GO:0030857 P negative regulation of epithelial cell differentiation
GO:0030957 F Tat protein binding
GO:0031410 C cytoplasmic vesicle
GO:0032693 P negative regulation of interleukin-10 production
GO:0034351 P negative regulation of glial cell apoptotic process
GO:0035265 P organ growth
GO:0040008 P regulation of growth
GO:0042472 P inner ear morphogenesis
GO:0042475 P odontogenesis of dentin-containing tooth
GO:0042491 P inner ear auditory receptor cell differentiation
GO:0045121 C membrane raft
GO:0045596 P negative regulation of cell differentiation
GO:0045605 P negative regulation of epidermal cell differentiation
GO:0045608 P negative regulation of inner ear auditory receptor cell differentiation
GO:0045638 P negative regulation of myeloid cell differentiation
GO:0045662 P negative regulation of myoblast differentiation
GO:0045665 P negative regulation of neuron differentiation
GO:0045747 P positive regulation of Notch signaling pathway
GO:0045807 P positive regulation of endocytosis
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046331 P lateral inhibition
GO:0048630 P skeletal muscle tissue growth
GO:0048631 P regulation of skeletal muscle tissue growth
GO:0048633 P positive regulation of skeletal muscle tissue growth
GO:0048665 P neuron fate specification
GO:0048839 P inner ear development
GO:0050767 P regulation of neurogenesis
GO:0051302 P regulation of cell division
GO:0060041 P retina development in camera-type eye
GO:0060042 P retina morphogenesis in camera-type eye
GO:0060853 P Notch signaling pathway involved in arterial endothelial cell fate commitment
GO:0061314 P Notch signaling involved in heart development
GO:0070986 P left/right axis specification
GO:0072006 P nephron development
GO:0072014 P proximal tubule development
GO:0072070 P loop of Henle development
GO:0072583 P clathrin-dependent endocytosis
GO:0097102 P endothelial tip cell fate specification
GO:0097110 F scaffold protein binding
GO:0097150 P neuronal stem cell population maintenance
GO:0098773 P skin epidermis development
GO:1900746 P regulation of vascular endothelial growth factor signaling pathway
GO:1903672 P positive regulation of sprouting angiogenesis
GO:2000505 P energy homeostasis
RNA-seq EntryA_BomoN4EE_TR17114_c0_g1_i1
Sequence
(Amino Acid)
FKFNYTWIKMRHAILLLICTAPAVLPKRTVKIPLWKRQACEPPAALSEHSHYICNDKGEP
KCMPGWQGDLCDVPICRKGCDPIRGFCKKPGECTCKFGYY
(32 a.a.)

- SilkBase 1999-2023 -