SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoN4EE12269_complete:A_BomoN4EE_TR30082_c0_g2_i2
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)		PREDICTED:_LOW_QUALITY_PROTEIN:_uncharacterized_protein_LOC101743043_[Bombyx_mori]
Ontology
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005776 C autophagosome
GO:0005829 C cytosol
GO:0005930 C axoneme
GO:0006914 P autophagy
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0008285 P negative regulation of cell population proliferation
GO:0021915 P neural tube development
GO:0030154 P cell differentiation
GO:0031410 C cytoplasmic vesicle
GO:0031625 F ubiquitin protein ligase binding
GO:0043524 P negative regulation of neuron apoptotic process
GO:0043552 P positive regulation of phosphatidylinositol 3-kinase activity
GO:0045335 C phagocytic vesicle
GO:0061734 P parkin-mediated stimulation of mitophagy in response to mitochondrial depolarization
GO:0098779 P positive regulation of mitophagy in response to mitochondrial depolarization
GO:1903599 P positive regulation of autophagy of mitochondrion
GO:2000785 P regulation of autophagosome assembly
RNA-seq EntryA_BomoN4EE_TR30082_c0_g2_i2
Sequence
(Amino Acid)
MRNTNHWLGVYSLEWGRLGQCLHTAVLEQTAVSVALSPTARHLAVGLGSKRFTSTHRAHN
HVFALLYKLDSLDSSSRTGLSPIKELEQNWEQGFTSLNCLRWAPQPGQGLVYANNAGQLI
VMS
*(40 a.a.)

- SilkBase 1999-2023 -