SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoN4EE12077_complete:A_BomoN4EE_TR30063_c1_g1_i8
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)
PREDICTED:_adenylate_cyclase_type_8_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0004016 F adenylate cyclase activity
GO:0005515 F protein binding
GO:0005516 F calmodulin binding
GO:0005524 F ATP binding
GO:0005622 C intracellular anatomical structure
GO:0005886 C plasma membrane
GO:0006171 P cAMP biosynthetic process
GO:0007189 P adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007193 P adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0008022 F protein C-terminus binding
GO:0008294 F calcium- and calmodulin-responsive adenylate cyclase activity
GO:0009190 P cyclic nucleotide biosynthetic process
GO:0014070 P response to organic cyclic compound
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016829 F lyase activity
GO:0016849 F phosphorus-oxygen lyase activity
GO:0019933 P cAMP-mediated signaling
GO:0035556 P intracellular signal transduction
GO:0046872 F metal ion binding
GO:0047485 F protein N-terminus binding
GO:0071277 P cellular response to calcium ion
RNA-seq EntryA_BomoN4EE_TR30063_c1_g1_i8
Sequence
(Amino Acid)
MLILMAMFLAVVIYHGRLVEVTSRLDFLWKLQAETDLGEMEDTQRINRHLLKHILPDHVV
THFLSKDRCPNELYSQWRDEVGVMFAGIPNFHEFYSETKAVDCMRLLNEIISNVPTLK
*(38 a.a.)

- SilkBase 1999-2023 -