SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoN4EE116_internal:A_BomoN4EE_TR1849_c0_g1_i1
Scaffold_idBomo_Chr18
NCBI non-redundant
(nr)		PREDICTED:_uncharacterized_protein_LOC101743267_[Bombyx_mori]
Ontology
GO:0003674 F molecular_function
GO:0005096 F GTPase activator activity
GO:0005575 C cellular_component
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0008150 P biological_process
GO:0014069 C postsynaptic density
GO:0016020 C membrane
GO:0030054 C cell junction
GO:0031532 P actin cytoskeleton reorganization
GO:0043005 C neuron projection
GO:0043087 P regulation of GTPase activity
GO:0043197 C dendritic spine
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0046875 F ephrin receptor binding
GO:0048013 P ephrin receptor signaling pathway
GO:0048167 P regulation of synaptic plasticity
GO:0048814 P regulation of dendrite morphogenesis
GO:0050770 P regulation of axonogenesis
GO:0051056 P regulation of small GTPase mediated signal transduction
GO:0061001 P regulation of dendritic spine morphogenesis
GO:0090630 P activation of GTPase activity
RNA-seq EntryA_BomoN4EE_TR1849_c0_g1_i1
Sequence
(Amino Acid)
GRSGSLDEAAEDSSNGGSTPKKKTVIEEQWERSGGFELTSVEQETYEKYFYGTEHWNYFT
NDEDLGPVILSIKQETLNSRDQFRILVRAISYTVHGLIPASCVFADRYNREEVVRSLGKE
VNINPPLMLGQLPDTPEELLKLDQVFIKSELKVGVIYVKENQYTEEEILDNN
(56 a.a.)

- SilkBase 1999-2023 -