| Name | O_BomoN4EE1166_internal:A_BomoN4EE_TR16288_c0_g1_i1 |
| Scaffold_id | Bomo_Chr4 |
NCBI non-redundant
(nr) | PREDICTED:_dual_specificity_tyrosine-phosphorylation-regulated_kinase_2-like_isoform_X2_[Papilio_xuthus] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0004672 |
F |
protein kinase activity |
| GO:0004674 |
F |
protein serine/threonine kinase activity |
| GO:0004712 |
F |
protein serine/threonine/tyrosine kinase activity |
| GO:0004713 |
F |
protein tyrosine kinase activity |
| GO:0005524 |
F |
ATP binding |
| GO:0005737 |
C |
cytoplasm |
| GO:0005829 |
C |
cytosol |
| GO:0006468 |
P |
protein phosphorylation |
| GO:0007608 |
P |
sensory perception of smell |
| GO:0009416 |
P |
response to light stimulus |
| GO:0016301 |
F |
kinase activity |
| GO:0016310 |
P |
phosphorylation |
| GO:0016740 |
F |
transferase activity |
| GO:0018108 |
P |
peptidyl-tyrosine phosphorylation |
| GO:0042048 |
P |
olfactory behavior |
|
| RNA-seq Entry | A_BomoN4EE_TR16288_c0_g1_i1 |
Sequence
(Amino Acid) | LCISLELMSINLYELIKKNNYQGFSLSLIRRFASSLLRCLRLLEAENIIHCDLKPENILL
KARGSSSIKVIDFGSSCYTDARVYTYIQSRFYRSPEVILGLQYGPAIDMWSMGCILA
(38 a.a.) |
