| Name | O_BomoN4EE11320_complete:A_BomoN4EE_TR29316_c0_g1_i2 |
| Scaffold_id | Bomo_Chr12 |
NCBI non-redundant
(nr) | Uncharacterized_protein_OBRU01_23880,_partial_[Operophtera_brumata] |
| Ontology |
| GO:0004177 |
F |
aminopeptidase activity |
| GO:0005737 |
C |
cytoplasm |
| GO:0005887 |
C |
integral component of plasma membrane |
| GO:0006508 |
P |
proteolysis |
| GO:0007165 |
P |
signal transduction |
| GO:0007267 |
P |
cell-cell signaling |
| GO:0008217 |
P |
regulation of blood pressure |
| GO:0008233 |
F |
peptidase activity |
| GO:0008237 |
F |
metallopeptidase activity |
| GO:0008270 |
F |
zinc ion binding |
| GO:0016020 |
C |
membrane |
| GO:0016021 |
C |
integral component of membrane |
| GO:0016787 |
F |
hydrolase activity |
| GO:0042277 |
F |
peptide binding |
| GO:0043171 |
P |
peptide catabolic process |
| GO:0046872 |
F |
metal ion binding |
| GO:0070006 |
F |
metalloaminopeptidase activity |
| GO:0070062 |
C |
extracellular exosome |
|
| RNA-seq Entry | A_BomoN4EE_TR29316_c0_g1_i2 |
Sequence
(Amino Acid) | MKDNIFKGTVNIAIEVLTSTNKITMHAYKLTIESVILKDSKNVEVSISSINISTDKRELL
RIHLNDQIQRGKYNVEIVFQGNMDKKIIGFYSSSLKNGG
*(32 a.a.) |
