| Name | O_BomoN4EE1117_complete:A_BomoN4EE_TR15589_c0_g1_i1 |
| Scaffold_id | Bomo_Chr3 |
NCBI non-redundant (nr) | PREDICTED:_protein_aveugle_[Amyelois_transitella] |
| Ontology |
| GO:0001751 |
P |
compound eye photoreceptor cell differentiation |
| GO:0001754 |
P |
eye photoreceptor cell differentiation |
| GO:0003674 |
F |
molecular_function |
| GO:0005515 |
F |
protein binding |
| GO:0005737 |
C |
cytoplasm |
| GO:0005886 |
C |
plasma membrane |
| GO:0007165 |
P |
signal transduction |
| GO:0007173 |
P |
epidermal growth factor receptor signaling pathway |
| GO:0007601 |
P |
visual perception |
| GO:0016020 |
C |
membrane |
| GO:0042675 |
P |
compound eye cone cell differentiation |
| GO:0046579 |
P |
positive regulation of Ras protein signal transduction |
| GO:0050896 |
P |
response to stimulus |
| GO:0070374 |
P |
positive regulation of ERK1 and ERK2 cascade |
|
| RNA-seq Entry | A_BomoN4EE_TR15589_c0_g1_i1 |
Sequence (Amino Acid) | MVEEPNLNSSKPKAKTTRPKAIYLWTEADVQKWLRRHCSDYYHMYWESFHEHDITGRALV
RINDNTLLRMGINNKDHREAIWREILKLRLKADIVEIRDLERRHNYFNYDL
*(36 a.a.) |