SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoN4EE11116_complete:A_BomoN4EE_TR29270_c0_g1_i2
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)		PREDICTED:_cyclic_nucleotide-gated_cation_channel_beta-3_isoform_X1_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0005216 F ion channel activity
GO:0005222 F intracellular cAMP-activated cation channel activity
GO:0005223 F intracellular cGMP-activated cation channel activity
GO:0005249 F voltage-gated potassium channel activity
GO:0005516 F calmodulin binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006813 P potassium ion transport
GO:0007608 P sensory perception of smell
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0017071 C intracellular cyclic nucleotide activated cation channel complex
GO:0030552 F cAMP binding
GO:0030553 F cGMP binding
GO:0034220 P ion transmembrane transport
GO:0043204 C perikaryon
GO:0050896 P response to stimulus
GO:0051289 P protein homotetramerization
GO:0051290 P protein heterotetramerization
GO:0051899 P membrane depolarization
GO:0055085 P transmembrane transport
GO:0071805 P potassium ion transmembrane transport
GO:0098655 P cation transmembrane transport
RNA-seq EntryA_BomoN4EE_TR29270_c0_g1_i2
Sequence
(Amino Acid)
MKRDVALAVHMSTLSKVQLFRDCSDSLLRDLVLQLRPVSFLPGDLVVRSGDVGHQMYIIK
TGECCVMSQDETEVLATLREGSVFGEISLLGIEGLRRRTATVRSRGYSSLFALSRSDLDA
ALEYHKEAAKVLRIRADQIIRENAARQTKQRLAALEARKSAELAKRQESALRRKSTVSGH
SNATEGRRLRAPSATSKRRLSTVSEKKNPRARGYRTLASTCTGIRTPLPTIVFTAE
*(78 a.a.)

- SilkBase 1999-2023 -