SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoN4EE11083_complete:A_BomoN4EE_TR29262_c0_g8_i2
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)		PREDICTED:_probable_medium-chain_specific_acyl-CoA_dehydrogenase,_mitochondrial_isoform_X1_[Papilio_polytes]
Ontology
GO:0000062 F fatty-acyl-CoA binding
GO:0001889 P liver development
GO:0003995 F acyl-CoA dehydrogenase activity
GO:0005739 C mitochondrion
GO:0005759 C mitochondrial matrix
GO:0005777 C peroxisome
GO:0005978 P glycogen biosynthetic process
GO:0006082 P organic acid metabolic process
GO:0006111 P regulation of gluconeogenesis
GO:0006629 P lipid metabolic process
GO:0006631 P fatty acid metabolic process
GO:0007507 P heart development
GO:0008152 P metabolic process
GO:0009055 F electron transfer activity
GO:0009409 P response to cold
GO:0009437 P carnitine metabolic process
GO:0009791 P post-embryonic development
GO:0016491 F oxidoreductase activity
GO:0016627 F oxidoreductase activity, acting on the CH-CH group of donors
GO:0019254 P carnitine metabolic process, CoA-linked
GO:0033539 P fatty acid beta-oxidation using acyl-CoA dehydrogenase
GO:0042594 P response to starvation
GO:0050660 F flavin adenine dinucleotide binding
GO:0051791 P medium-chain fatty acid metabolic process
GO:0052890 F oxidoreductase activity, acting on the CH-CH group of donors, with a flavin as acceptor
GO:0055007 P cardiac muscle cell differentiation
GO:0055088 P lipid homeostasis
GO:0055114 P obsolete oxidation-reduction process
GO:0070991 F medium-chain-acyl-CoA dehydrogenase activity
RNA-seq EntryA_BomoN4EE_TR29262_c0_g8_i2
Sequence
(Amino Acid)
MNPLAQIVRATRPIYRKLSTTATTASAAKPIPTTGFCFELTDEQKALQELARKFTKDEII
PVAGQYDKTGEYPWPVVKKAWEVGLMNGHIPEHCGGIGNFGVFEECIVADELAFGCTGIT
TAIGGTSLGVSHTIERLKKLL
*(46 a.a.)

- SilkBase 1999-2023 -