SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoN4EE1103_5prime_partial:A_BomoN4EE_TR15090_c0_g1_i1
Scaffold_idBomo_Chr16
NCBI non-redundant
(nr)
PREDICTED:_cell_division_control_protein_45_homolog_[Amyelois_transitella]
Ontology
GO:0000076 P DNA replication checkpoint signaling
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0000083 P regulation of transcription involved in G1/S transition of mitotic cell cycle
GO:0000727 P double-strand break repair via break-induced replication
GO:0003682 F chromatin binding
GO:0003688 F DNA replication origin binding
GO:0003697 F single-stranded DNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005656 C nuclear pre-replicative complex
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0006260 P DNA replication
GO:0006267 P pre-replicative complex assembly involved in nuclear cell cycle DNA replication
GO:0006270 P DNA replication initiation
GO:0007049 P cell cycle
GO:0031261 C DNA replication preinitiation complex
GO:0031298 C replication fork protection complex
GO:0031938 P obsolete regulation of chromatin silencing at telomere
GO:0032508 P DNA duplex unwinding
GO:0043138 F 3'-5' DNA helicase activity
GO:1900087 P positive regulation of G1/S transition of mitotic cell cycle
GO:1902977 P mitotic DNA replication preinitiation complex assembly
RNA-seq EntryA_BomoN4EE_TR15090_c0_g1_i1
Sequence
(Amino Acid)
AALAGATLAARALHHAGPFAHFTISEGAAECEWGPWWLAVCARWVGAGAGRGAAAVLVAA
PRGRTVLLCGVPPPQRTDTRNLFGAAFEQAAAKCGASVSLDHFDSAVVTLPAAQRPQFLD
ALTALLA
*(41 a.a.)

- SilkBase 1999-2023 -