SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoN4EE10905_internal:A_BomoN4EE_TR29196_c0_g1_i1
Scaffold_idBomo_Chr21
NCBI non-redundant
(nr)		PREDICTED:_serine_protease_snake-like_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001525 P angiogenesis
GO:0004252 F serine-type endopeptidase activity
GO:0005515 F protein binding
GO:0005615 C extracellular space
GO:0005622 C intracellular anatomical structure
GO:0005886 C plasma membrane
GO:0006508 P proteolysis
GO:0006879 P cellular iron ion homeostasis
GO:0008233 F peptidase activity
GO:0008236 F serine-type peptidase activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016787 F hydrolase activity
GO:0030198 P extracellular matrix organization
GO:0030514 P negative regulation of BMP signaling pathway
GO:0033619 P membrane protein proteolysis
GO:0035556 P intracellular signal transduction
GO:0042730 P fibrinolysis
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0055072 P iron ion homeostasis
GO:0097264 P self proteolysis
RNA-seq EntryA_BomoN4EE_TR29196_c0_g1_i1
Sequence
(Amino Acid)
PPNKYYDIALMELDHDVEFSKYVFPSCLWSKPDIAELGTSATVTGWGALHEGSSDISPEL
QAGDVNVIDSDMCDQLLQAYCNRNWCGLMDHQLCAGKLTD
(32 a.a.)

- SilkBase 1999-2023 -