SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoN4EE1084_internal:A_BomoN4EE_TR14849_c0_g1_i1
Scaffold_idBomo_Chr27
NCBI non-redundant
(nr)		PREDICTED:_muscle_calcium_channel_subunit_alpha-1-like_[Bombyx_mori]
Ontology
GO:0005216 F ion channel activity
GO:0005244 F voltage-gated ion channel activity
GO:0005245 F voltage-gated calcium channel activity
GO:0005262 F calcium channel activity
GO:0005891 C voltage-gated calcium channel complex
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006816 P calcium ion transport
GO:0006936 P muscle contraction
GO:0008331 F high voltage-gated calcium channel activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016323 C basolateral plasma membrane
GO:0016324 C apical plasma membrane
GO:0034765 P regulation of ion transmembrane transport
GO:0042045 P epithelial fluid transport
GO:0046872 F metal ion binding
GO:0055085 P transmembrane transport
GO:0070588 P calcium ion transmembrane transport
GO:0086010 P membrane depolarization during action potential
RNA-seq EntryA_BomoN4EE_TR14849_c0_g1_i1
Sequence
(Amino Acid)
PGDPNEITVGKFYATFLIQDYFRRFKKRKEQELRQNDEQTHQMTLQAGLRTLHEAGPELK
RAISGNLDDITAELDVPMHRRNHSLFGGVWSSIRRHGPNRHLHRHRKEPPPGKNKPNLLY
PNIDYEKLLH
(42 a.a.)

- SilkBase 1999-2023 -