SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoN4EE10783_5prime_partial:A_BomoN4EE_TR28680_c0_g1_i1
Scaffold_idBomo_Chr16
NCBI non-redundant
(nr)
PREDICTED:_fatty_acid_synthase-like_[Bombyx_mori]
Ontology
GO:0001649 P osteoblast differentiation
GO:0003824 F catalytic activity
GO:0004312 F fatty acid synthase activity
GO:0004313 F [acyl-carrier-protein] S-acetyltransferase activity
GO:0004314 F [acyl-carrier-protein] S-malonyltransferase activity
GO:0004315 F 3-oxoacyl-[acyl-carrier-protein] synthase activity
GO:0004316 F 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity
GO:0004317 F 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase activity
GO:0004319 F enoyl-[acyl-carrier-protein] reductase (NADPH, B-specific) activity
GO:0004320 F oleoyl-[acyl-carrier-protein] hydrolase activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006084 P acetyl-CoA metabolic process
GO:0006629 P lipid metabolic process
GO:0006631 P fatty acid metabolic process
GO:0006633 P fatty acid biosynthetic process
GO:0008144 F obsolete drug binding
GO:0008152 P metabolic process
GO:0009058 P biosynthetic process
GO:0015939 P pantothenate metabolic process
GO:0016020 C membrane
GO:0016295 F myristoyl-[acyl-carrier-protein] hydrolase activity
GO:0016296 F palmitoyl-[acyl-carrier-protein] hydrolase activity
GO:0016297 F acyl-[acyl-carrier-protein] hydrolase activity
GO:0016491 F oxidoreductase activity
GO:0016740 F transferase activity
GO:0016787 F hydrolase activity
GO:0016788 F hydrolase activity, acting on ester bonds
GO:0016829 F lyase activity
GO:0019171 F 3-hydroxyacyl-[acyl-carrier-protein] dehydratase activity
GO:0030879 P mammary gland development
GO:0031177 F phosphopantetheine binding
GO:0031325 P positive regulation of cellular metabolic process
GO:0035338 P long-chain fatty-acyl-CoA biosynthetic process
GO:0042470 C melanosome
GO:0042587 C glycogen granule
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0044822 F RNA binding
GO:0047117 F enoyl-[acyl-carrier-protein] reductase (NADPH, A-specific) activity
GO:0047451 F 3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase activity
GO:0055114 P obsolete oxidation-reduction process
GO:0070062 C extracellular exosome
GO:0070402 F NADPH binding
GO:0071353 P cellular response to interleukin-4
RNA-seq EntryA_BomoN4EE_TR28680_c0_g1_i1
Sequence
(Amino Acid)
HDQRQLRLTVALHRGTGRFEVLDEFIKVATGYITNVQEVYKFTTETALKRNGMEINSNDI
YELLNVRDYSYGEDFQTIHQGNLALDSFSMLWKNNWVTLIDGLLQVNVLRQRHVGVSQPT
EIRNLSINVSEHEKHITNIDGKNVVQARVFKQYETTT
*(51 a.a.)

- SilkBase 1999-2023 -