SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoN4EE1075_internal:A_BomoN4EE_TR14551_c0_g1_i1
Scaffold_idBomo_Chr12
NCBI non-redundant
(nr)		PREDICTED:_LOW_QUALITY_PROTEIN:_multidrug_resistance-associated_protein_1-like_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0005215 F transporter activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006855 P xenobiotic transmembrane transport
GO:0006979 P response to oxidative stress
GO:0008152 P metabolic process
GO:0008514 F organic anion transmembrane transporter activity
GO:0009408 P response to heat
GO:0009986 C cell surface
GO:0015127 F bilirubin transmembrane transporter activity
GO:0015723 P bilirubin transport
GO:0015732 P prostaglandin transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016324 C apical plasma membrane
GO:0016887 F ATP hydrolysis activity
GO:0019904 F protein domain specific binding
GO:0030644 P cellular chloride ion homeostasis
GO:0031427 P response to methotrexate
GO:0042493 P response to xenobiotic stimulus
GO:0042626 F ATPase-coupled transmembrane transporter activity
GO:0043225 F ATPase-coupled inorganic anion transmembrane transporter activity
GO:0043627 P response to estrogen
GO:0046581 C intercellular canaliculus
GO:0046685 P response to arsenic-containing substance
GO:0048545 P response to steroid hormone
GO:0055085 P transmembrane transport
GO:0070327 P thyroid hormone transport
GO:0098656 P anion transmembrane transport
RNA-seq EntryA_BomoN4EE_TR14551_c0_g1_i1
Sequence
(Amino Acid)
LHHLSDAERSSVEFVRKQDHEYRCSRTESHQNLQRIRLHSESNSEAEDRSGKLAISFKRS
IEEIILNKSAEHVSYTEKEKSERGSVSWMVYKHYLKNIGVLAAAATILMNVVLQLFHIGS
SYWLAEWSDNENEVVNSTMNLNQRNKYLAVYAGLGMGQAISSFLADLIPYLACWRAAK
(58 a.a.)

- SilkBase 1999-2023 -