SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoN4EE10689_3prime_partial:A_BomoN4EE_TR28449_c0_g2_i1
Scaffold_idBomo_Chr6
NCBI non-redundant
(nr)
PREDICTED:_peripheral_plasma_membrane_protein_CASK_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004683 F calmodulin-dependent protein kinase activity
GO:0005515 F protein binding
GO:0005516 F calmodulin binding
GO:0005524 F ATP binding
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005954 C calcium- and calmodulin-dependent protein kinase complex
GO:0006468 P protein phosphorylation
GO:0007155 P cell adhesion
GO:0007163 P establishment or maintenance of cell polarity
GO:0007269 P neurotransmitter secretion
GO:0007274 P neuromuscular synaptic transmission
GO:0007298 P border follicle cell migration
GO:0007615 P anesthesia-resistant memory
GO:0007616 P long-term memory
GO:0007628 P adult walking behavior
GO:0008049 P male courtship behavior
GO:0008344 P adult locomotory behavior
GO:0008360 P regulation of cell shape
GO:0008582 P regulation of synaptic assembly at neuromuscular junction
GO:0016020 C membrane
GO:0016080 P synaptic vesicle targeting
GO:0016081 P synaptic vesicle docking
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0019233 P sensory perception of pain
GO:0031594 C neuromuscular junction
GO:0040011 P locomotion
GO:0040012 P regulation of locomotion
GO:0042043 F neurexin family protein binding
GO:0046331 P lateral inhibition
GO:0046928 P regulation of neurotransmitter secretion
GO:0048488 P synaptic vesicle endocytosis
GO:0061174 C type I terminal bouton
GO:0072375 P medium-term memory
GO:1900073 P regulation of neuromuscular synaptic transmission
GO:1900244 P positive regulation of synaptic vesicle endocytosis
GO:2000331 P regulation of terminal button organization
RNA-seq EntryA_BomoN4EE_TR28449_c0_g2_i1
Sequence
(Amino Acid)
MAEDEVLFDDVYELCEIIGKGPFSLVRRCVHRQTAQQFAVKIVDVARFTASPGLSTADLK
REATICHMLKHPHIVELLETYSSEGMLYMVFEYMDGSDLCFEVVRRASAGFVYSEAVACH
YMRQILEALRYCHENDIVHRDVRPHCVLLAGRDNCAPVKLGGFGVAAQLPTPTSHRAPPE
LVMDNRPLMGPMGQAYLKSD
(65 a.a.)

- SilkBase 1999-2023 -