SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoN4EE1038_3prime_partial:A_BomoN4EE_TR14096_c0_g1_i1
Scaffold_idBomo_Chr9
NCBI non-redundant
(nr)		PREDICTED:_V-type_proton_ATPase_116_kDa_subunit_a_isoform_1-like_[Bombyx_mori]
Ontology
GO:0000220 C vacuolar proton-transporting V-type ATPase, V0 domain
GO:0001669 C acrosomal vesicle
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005765 C lysosomal membrane
GO:0005768 C endosome
GO:0005886 C plasma membrane
GO:0005925 C focal adhesion
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006955 P immune response
GO:0007035 P vacuolar acidification
GO:0008286 P insulin receptor signaling pathway
GO:0010008 C endosome membrane
GO:0015078 F proton transmembrane transporter activity
GO:0015986 P ATP synthesis coupled proton transport
GO:0015991 P proton transmembrane transport
GO:0015992 P proton transmembrane transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016241 P regulation of macroautophagy
GO:0016471 C vacuolar proton-transporting V-type ATPase complex
GO:0030670 C phagocytic vesicle membrane
GO:0033179 C proton-transporting V-type ATPase, V0 domain
GO:0033572 P transferrin transport
GO:0034220 P ion transmembrane transport
GO:0046961 F proton-transporting ATPase activity, rotational mechanism
GO:0051117 F ATPase binding
GO:0070072 P vacuolar proton-transporting V-type ATPase complex assembly
GO:0090383 P phagosome acidification
RNA-seq EntryA_BomoN4EE_TR14096_c0_g1_i1
Sequence
(Amino Acid)
MIYLQYVPQILFLMLLFWYLCILMFMKWTMYSATATDPTYGTSCAPSVLITFINMMLLKG
SEDSPPCKAMMFDGQDALQKLFLTLGFLCIPIMLFGKPAFLFWQARNRKRHEVGGERG
(38 a.a.)

- SilkBase 1999-2023 -