SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoN4EE1031_internal:A_BomoN4EE_TR13980_c0_g1_i1
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)		PREDICTED:_metabotropic_glutamate_receptor-like,_partial_[Amyelois_transitella]
Ontology
GO:0001641 F group II metabotropic glutamate receptor activity
GO:0004871 F obsolete signal transducer activity
GO:0004930 F G protein-coupled receptor activity
GO:0005246 F calcium channel regulator activity
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0007165 P signal transduction
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007196 P adenylate cyclase-inhibiting G protein-coupled glutamate receptor signaling pathway
GO:0014047 P glutamate secretion
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030054 C cell junction
GO:0030424 C axon
GO:0030425 C dendrite
GO:0042734 C presynaptic membrane
GO:0042995 C cell projection
GO:0043005 C neuron projection
GO:0045202 C synapse
GO:0046928 P regulation of neurotransmitter secretion
GO:0051966 P regulation of synaptic transmission, glutamatergic
RNA-seq EntryA_BomoN4EE_TR13980_c0_g1_i1
Sequence
(Amino Acid)
SCCWHCFNCTQYEIRSPYVETACMVCPRGTLPDLTRTQCRPIPEAYLRPDSAWAIGAMSF
SSVGILLTAFVCGVWVRHSSTPVVRASGRELSYVLLAGILMCYLVTFALVFRPTDILCSI
QRFGTGFCFTVIYAALLTKTNRISRIFNASKHSAKRPILISPTSQ
(54 a.a.)

- SilkBase 1999-2023 -