SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoN4EE1027_5prime_partial:A_BomoN4EE_TR13961_c0_g1_i1
Scaffold_idBomo_Chr17
NCBI non-redundant
(nr)
PREDICTED:_nuclear_pore_complex_protein_Nup85_[Amyelois_transitella]
Ontology
GO:0000775 C chromosome, centromeric region
GO:0000776 C kinetochore
GO:0000777 C kinetochore
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005635 C nuclear envelope
GO:0005643 C nuclear pore
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005819 C spindle
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0006406 P mRNA export from nucleus
GO:0006409 P tRNA export from nucleus
GO:0006606 P protein import into nucleus
GO:0006810 P transport
GO:0006935 P chemotaxis
GO:0007062 P sister chromatid cohesion
GO:0007077 P mitotic nuclear membrane disassembly
GO:0010827 P regulation of glucose transmembrane transport
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016032 P viral process
GO:0016925 P protein sumoylation
GO:0017056 F structural constituent of nuclear pore
GO:0019083 P viral transcription
GO:0030032 P lamellipodium assembly
GO:0031047 P gene silencing by RNA
GO:0031080 C nuclear pore outer ring
GO:0031965 C nuclear membrane
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0048246 P macrophage chemotaxis
GO:0051028 P mRNA transport
GO:0075733 P intracellular transport of virus
GO:1900034 P regulation of cellular response to heat
RNA-seq EntryA_BomoN4EE_TR13961_c0_g1_i1
Sequence
(Amino Acid)
GGAAGRAGRCAGAALRHYCRTGCLPAPDLLLTAGPALLIDDTLLFLGKYCEFHRMYKNKE
FRKAAQLLISLITSKIAPDFFWETLLLDALPLLESDEAMFTADDTYDMMLCLELRAQNFN
REKAELLRLALLRNLARTALAEKPEESTQ
*(49 a.a.)

- SilkBase 1999-2023 -