| Name | O_BomoN4EE1019_internal:A_BomoN4EE_TR13657_c0_g1_i1 |
| Scaffold_id | Bomo_Chr21 |
NCBI non-redundant
(nr) | Bumetanide-sensitive_sodium-(Potassium)-chloride_cotransporter,_partial_[Operophtera_brumata] |
| Ontology |
| GO:0005215 |
F |
transporter activity |
| GO:0005515 |
F |
protein binding |
| GO:0005829 |
C |
cytosol |
| GO:0005886 |
C |
plasma membrane |
| GO:0005887 |
C |
integral component of plasma membrane |
| GO:0006810 |
P |
transport |
| GO:0006811 |
P |
ion transport |
| GO:0006814 |
P |
sodium ion transport |
| GO:0006821 |
P |
chloride transport |
| GO:0015293 |
F |
symporter activity |
| GO:0015377 |
F |
cation:chloride symporter activity |
| GO:0015378 |
F |
sodium:chloride symporter activity |
| GO:0016020 |
C |
membrane |
| GO:0016021 |
C |
integral component of membrane |
| GO:0016324 |
C |
apical plasma membrane |
| GO:0019899 |
F |
enzyme binding |
| GO:0031982 |
C |
vesicle |
| GO:0035725 |
P |
sodium ion transmembrane transport |
| GO:0055085 |
P |
transmembrane transport |
| GO:0070062 |
C |
extracellular exosome |
| GO:1902476 |
P |
chloride transmembrane transport |
|
| RNA-seq Entry | A_BomoN4EE_TR13657_c0_g1_i1 |
Sequence
(Amino Acid) | RKLRAFYVLLQGLDLKRGANALMQASGLGKLSPNILLIGFKKDWTNAEHKQISDYYGVIQ
DAFDLKLAVTILRVPGTSQTVQRWRWTPRVVSEPNNFELVMHTQVLALMNSDSDLEDDDQ
AIDDDSDKLIDSENQLSNETSSSEQNPESI
(49 a.a.) |
