SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoN4EE10154_complete:A_BomoN4EE_TR28401_c0_g3_i4
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)		PREDICTED:_active_breakpoint_cluster_region-related_protein_isoform_X3_[Bombyx_mori]
Ontology
GO:0002692 P negative regulation of cellular extravasation
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005089 F guanyl-nucleotide exchange factor activity
GO:0005096 F GTPase activator activity
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0007165 P signal transduction
GO:0007420 P brain development
GO:0016020 C membrane
GO:0030036 P actin cytoskeleton organization
GO:0030336 P negative regulation of cell migration
GO:0032496 P response to lipopolysaccharide
GO:0035023 P regulation of Rho protein signal transduction
GO:0035556 P intracellular signal transduction
GO:0042472 P inner ear morphogenesis
GO:0043114 P regulation of vascular permeability
GO:0043314 P negative regulation of neutrophil degranulation
GO:0043547 P positive regulation of GTPase activity
GO:0050728 P negative regulation of inflammatory response
GO:0050766 P positive regulation of phagocytosis
GO:0050885 P neuromuscular process controlling balance
GO:0060313 P negative regulation of blood vessel remodeling
RNA-seq EntryA_BomoN4EE_TR28401_c0_g3_i4
Sequence
(Amino Acid)
MILFNRREKRNIPFIISACVREVERRGLHEVGVYRVSGSASDLNRLKKSFETNPYEAEQL
LKEVDIHSVTGVLKLYLRELPEALFTDALYPELLKAWGSVQGVGISVDSGPAHTRRHALL
KCYAQLPDLNKNCIDFLLNHFVKVNQHEGENKMSLHNLATVFGPTLLRPASGGGGAGGKQ
RSDPLAAGTVDAMAQAGILYCLLQHRQLAAQLSSHHRAPHHVLD
*(74 a.a.)

- SilkBase 1999-2023 -