| Name | O_BomoN4EE10048_complete:A_BomoN4EE_TR28389_c0_g1_i4 |
| Scaffold_id | Bomo_Chr16 |
NCBI non-redundant
(nr) | Heterogeneous_nuclear_ribonucleoprotein_R_[Papilio_xuthus] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0000398 |
P |
mRNA splicing, via spliceosome |
| GO:0003676 |
F |
nucleic acid binding |
| GO:0003723 |
F |
RNA binding |
| GO:0003730 |
F |
mRNA 3'-UTR binding |
| GO:0005515 |
F |
protein binding |
| GO:0005634 |
C |
nucleus |
| GO:0005654 |
C |
nucleoplasm |
| GO:0005681 |
C |
spliceosomal complex |
| GO:0005730 |
C |
nucleolus |
| GO:0005737 |
C |
cytoplasm |
| GO:0005783 |
C |
endoplasmic reticulum |
| GO:0006397 |
P |
mRNA processing |
| GO:0007623 |
P |
circadian rhythm |
| GO:0008380 |
P |
RNA splicing |
| GO:0010467 |
P |
gene expression |
| GO:0030425 |
C |
dendrite |
| GO:0030426 |
C |
growth cone |
| GO:0030529 |
C |
ribonucleoprotein complex |
| GO:0043086 |
P |
negative regulation of catalytic activity |
| GO:0043231 |
C |
intracellular membrane-bounded organelle |
| GO:0043679 |
C |
axon terminus |
| GO:0044822 |
F |
RNA binding |
| GO:0061014 |
P |
positive regulation of mRNA catabolic process |
| GO:0061157 |
P |
mRNA destabilization |
| GO:0071013 |
C |
catalytic step 2 spliceosome |
|
| RNA-seq Entry | A_BomoN4EE_TR28389_c0_g1_i4 |
Sequence
(Amino Acid) | MIGSNRHPGAAVVAPLSCRCRAVVAAAASAGGQYRRARTSESAIRRGPTGSESHFFKIVP
LLFFPQLDNHEIKPGKTLRIKISVPNLRLFVGNIPKSKGKEEILEEFGKLTGKVSLE
*(38 a.a.) |
