SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoN4EE10027_complete:A_BomoN4EE_TR28388_c0_g2_i4
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)		Dipeptidase_1_[Papilio_machaon]
Ontology
GO:0005515 F protein binding
GO:0005615 C extracellular space
GO:0005886 C plasma membrane
GO:0006508 P proteolysis
GO:0006691 P leukotriene metabolic process
GO:0006749 P glutathione metabolic process
GO:0006805 P xenobiotic metabolic process
GO:0008233 F peptidase activity
GO:0008235 F metalloexopeptidase activity
GO:0008237 F metallopeptidase activity
GO:0008239 F dipeptidyl-peptidase activity
GO:0008270 F zinc ion binding
GO:0016020 C membrane
GO:0016324 C apical plasma membrane
GO:0016787 F hydrolase activity
GO:0016805 F dipeptidase activity
GO:0016999 P antibiotic metabolic process
GO:0030336 P negative regulation of cell migration
GO:0031225 C anchored component of membrane
GO:0031528 C microvillus membrane
GO:0034235 F GPI anchor binding
GO:0035690 P cellular response to xenobiotic stimulus
GO:0042995 C cell projection
GO:0043027 F cysteine-type endopeptidase inhibitor activity involved in apoptotic process
GO:0043066 P negative regulation of apoptotic process
GO:0043154 P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0045177 C apical part of cell
GO:0046872 F metal ion binding
GO:0050667 P homocysteine metabolic process
GO:0070062 C extracellular exosome
GO:0070573 F metallodipeptidase activity
GO:0071277 P cellular response to calcium ion
GO:0071732 P cellular response to nitric oxide
GO:0072340 P cellular lactam catabolic process
GO:0072341 F modified amino acid binding
RNA-seq EntryA_BomoN4EE_TR28388_c0_g2_i4
Sequence
(Amino Acid)
MHERLRLAERLLHDTPLIDGHNDLPWNIRKFLHNKIKDFSFDEDLRTISPWATSSWSHTD
LPRLKQGRVAAQFWAAYVPCDAQHRDAVQLTFEQIDLIQRLTEKYQPQLTMCTSAEDIKI
AHANHRVCSLIGVEGGHAIGSSLGVLRTLYQVGVRYLTLTSTCDTPWAECASADRVEPSP
RGGLTAFGKVVIKEMNRLGMLVDLSHVSERTMRDALAVSRAPVLFSHSSARALCNVTRNV
PDTILRMLAANKGLIMVNFYTSFLTCKETATVQDAIAHINHIRNVAGVDSVGLGAGYDGI
NYTPQGLEDVSSYPLLFAELMEAGWSIEDLRKLAGLNLLRVMGATERVAKELAAARVVPY
EDVPPRIFDAHNCSSQDV
*(125 a.a.)

- SilkBase 1999-2023 -