SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoN4EE10000_complete:A_BomoN4EE_TR28384_c1_g5_i1
Scaffold_idBomo_Chr9
NCBI non-redundant
(nr)
PREDICTED:_myosin_heavy_chain_95F-like_[Plutella_xylostella]
Ontology
GO:0000146 F microfilament motor activity
GO:0000166 F nucleotide binding
GO:0003774 F cytoskeletal motor activity
GO:0003779 F actin binding
GO:0005515 F protein binding
GO:0005516 F calmodulin binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005875 C microtubule associated complex
GO:0005938 C cell cortex
GO:0006997 P nucleus organization
GO:0007015 P actin filament organization
GO:0007051 P spindle organization
GO:0007275 P multicellular organism development
GO:0007283 P spermatogenesis
GO:0007286 P spermatid development
GO:0007291 P sperm individualization
GO:0007297 P ovarian follicle cell migration
GO:0007298 P border follicle cell migration
GO:0007391 P dorsal closure
GO:0007552 P metamorphosis
GO:0007560 P imaginal disc morphogenesis
GO:0008017 F microtubule binding
GO:0008104 P protein localization
GO:0008152 P metabolic process
GO:0008363 P larval chitin-based cuticle development
GO:0016333 P morphogenesis of follicular epithelium
GO:0016459 C myosin complex
GO:0016461 C unconventional myosin complex
GO:0019749 P cytoskeleton-dependent cytoplasmic transport, nurse cell to oocyte
GO:0030036 P actin cytoskeleton organization
GO:0030048 P actin filament-based movement
GO:0030139 C endocytic vesicle
GO:0030317 P flagellated sperm motility
GO:0030426 C growth cone
GO:0030589 P pseudocleavage involved in syncytial blastoderm formation
GO:0031476 C myosin VI complex
GO:0031941 C filamentous actin
GO:0032027 F myosin light chain binding
GO:0032880 P regulation of protein localization
GO:0032956 P regulation of actin cytoskeleton organization
GO:0032970 P regulation of actin filament-based process
GO:0040001 P establishment of mitotic spindle localization
GO:0042623 F ATP hydrolysis activity
GO:0043234 C protein-containing complex
GO:0045167 P asymmetric protein localization involved in cell fate determination
GO:0045172 C germline ring canal
GO:0045175 P basal protein localization
GO:0045178 C basal part of cell
GO:0045217 P cell-cell junction maintenance
GO:0045921 P positive regulation of exocytosis
GO:0047497 P mitochondrion transport along microtubule
GO:0048477 P oogenesis
GO:0051015 F actin filament binding
GO:0051647 P nucleus localization
GO:0055057 P neuroblast division
GO:0055059 P asymmetric neuroblast division
GO:0061024 P membrane organization
GO:0070856 F myosin VI light chain binding
GO:0070864 C sperm individualization complex
GO:0070865 C investment cone
RNA-seq EntryA_BomoN4EE_TR28384_c1_g5_i1
Sequence
(Amino Acid)
MDAAKSPRVLQKGDILGARHRYFRIPFVRGGAGGDGGTRGWWYAHFDGQYVARQMELHPD
KTPVLLRAGADDMQMCELSLDETGLTRKRGAEILPHEFERQWTAHGGPAYAPPPR
*(37 a.a.)

- SilkBase 1999-2023 -