| Name | O_BomoMSG3921_internal:A_BomoMSG_c14645_g1_i1 |
| Scaffold_id | Bomo_Chr18 |
NCBI non-redundant
(nr) | DNA_repair_protein_REV1_[Bombyx_mori] |
| Ontology |
| GO:0003677 |
F |
DNA binding |
| GO:0003684 |
F |
damaged DNA binding |
| GO:0005515 |
F |
protein binding |
| GO:0005634 |
C |
nucleus |
| GO:0005654 |
C |
nucleoplasm |
| GO:0006260 |
P |
DNA replication |
| GO:0006281 |
P |
DNA repair |
| GO:0006974 |
P |
cellular response to DNA damage stimulus |
| GO:0009411 |
P |
response to UV |
| GO:0016740 |
F |
transferase activity |
| GO:0016779 |
F |
nucleotidyltransferase activity |
| GO:0017125 |
F |
deoxycytidyl transferase activity |
| GO:0019985 |
P |
translesion synthesis |
| GO:0042276 |
P |
error-prone translesion synthesis |
| GO:0046872 |
F |
metal ion binding |
| GO:0071897 |
P |
DNA biosynthetic process |
|
| RNA-seq Entry | A_BomoMSG_c14645_g1_i1 |
Sequence
(Amino Acid) | QNSINGTGNEINPEKLQVTKTAADPNFISEFYNNSRLHHISQLGACFKQYVNDLREQSNF
VFPARQNLKDIIKSSNNRLSQLVFEKGKTIMHIDMDCFFVSVGLRNRPELRDR
(36 a.a.) |
