SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG3686_internal:A_BomoMSG_c14121_g1_i1
Scaffold_idBomo_Chr6
NCBI non-redundant
(nr)		vacuolar_protein_sorting-associated_protein_16_homolog_[Bombyx_mori]
Ontology
GO:0003779 F actin binding
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005768 C endosome
GO:0005769 C early endosome
GO:0005770 C late endosome
GO:0005776 C autophagosome
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006914 P autophagy
GO:0007033 P vacuole organization
GO:0008333 P endosome to lysosome transport
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0030136 C clathrin-coated vesicle
GO:0030424 C axon
GO:0030897 C HOPS complex
GO:0031410 C cytoplasmic vesicle
GO:0031902 C late endosome membrane
GO:0032889 P regulation of vacuole fusion, non-autophagic
GO:0035542 P regulation of SNARE complex assembly
GO:0043025 C neuronal cell body
GO:0051015 F actin filament binding
GO:0055037 C recycling endosome
GO:0097352 P autophagosome maturation
RNA-seq EntryA_BomoMSG_c14121_g1_i1
Sequence
(Amino Acid)
FNMGQEVRDTKVCKAQLFPNPHGIGLAVITTTNRMFLVSNVSEPKARPVPDIPRANEPIS
CWCAVNSSFIVCRDKEIYKCQLGESRAILLRPEIKNPRS
(32 a.a.)

- SilkBase 1999-2023 -