SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG3630_internal:A_BomoMSG_c14017_g1_i1
Scaffold_idBomo_Chr9
NCBI non-redundant
(nr)		nuclear_factor_NF-kappa-B_p110_subunit_isoform_2_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0002230 P positive regulation of defense response to virus by host
GO:0002376 P immune system process
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005719 C euchromatin
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0006954 P inflammatory response
GO:0006955 P immune response
GO:0006963 P positive regulation of antibacterial peptide biosynthetic process
GO:0006964 P positive regulation of biosynthetic process of antibacterial peptides active against Gram-negative bacteria
GO:0006967 P positive regulation of antifungal peptide biosynthetic process
GO:0006974 P cellular response to DNA damage stimulus
GO:0007165 P signal transduction
GO:0007249 P I-kappaB kinase/NF-kappaB signaling
GO:0008063 P Toll signaling pathway
GO:0009617 P response to bacterium
GO:0010628 P positive regulation of gene expression
GO:0019233 P sensory perception of pain
GO:0033256 C I-kappaB/NF-kappaB complex
GO:0034097 P response to cytokine
GO:0034198 P cellular response to amino acid starvation
GO:0038061 P NIK/NF-kappaB signaling
GO:0043565 F sequence-specific DNA binding
GO:0045087 P innate immune response
GO:0045088 P regulation of innate immune response
GO:0045089 P positive regulation of innate immune response
GO:0045429 P positive regulation of nitric oxide biosynthetic process
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048813 P dendrite morphogenesis
GO:0048935 P peripheral nervous system neuron development
GO:0050829 P defense response to Gram-negative bacterium
GO:0051607 P defense response to virus
GO:0061057 P peptidoglycan recognition protein signaling pathway
GO:2000647 P negative regulation of stem cell proliferation
RNA-seq EntryA_BomoMSG_c14017_g1_i1
Sequence
(Amino Acid)
SSRSPQSYYSYCSPSQQVPQLTPDLNNLIYLDNGSKRNRPFLRIIEQPQDYFRFRYASEM
AGTHGCLLGKSSSTNKNKVHPTVELVNYTGQAVIKCQLAQHKTPEEHPHKLFEEEQDNDD
REVSCIVPKQGIYKVGFGGMGIIHTAKKNV
(49 a.a.)

- SilkBase 1999-2023 -