SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG3575_internal:A_BomoMSG_c13921_g1_i2
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)		glutamate_receptor_ionotropic,_NMDA_2B_[Bombyx_mori]
Ontology
GO:0001964 P startle response
GO:0004872 F signaling receptor activity
GO:0004970 F ionotropic glutamate receptor activity
GO:0004972 F NMDA glutamate receptor activity
GO:0005216 F ion channel activity
GO:0005234 F extracellularly glutamate-gated ion channel activity
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0008344 P adult locomotory behavior
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0017146 C NMDA selective glutamate receptor complex
GO:0030054 C cell junction
GO:0034220 P ion transmembrane transport
GO:0035235 P ionotropic glutamate receptor signaling pathway
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0050966 P detection of mechanical stimulus involved in sensory perception of pain
GO:0051930 P regulation of sensory perception of pain
GO:0060079 P excitatory postsynaptic potential
RNA-seq EntryA_BomoMSG_c13921_g1_i2
Sequence
(Amino Acid)
ALPICGFCIDLLQQLAEHLGFTYELVRVEDGRWGTLHYGKWNGLIADLVNKKTDMVLTSL
IINSDREAVVDFSVPFMETGVAIVVAKRTGIISPTAFLEPFDTASWMLV
(35 a.a.)

- SilkBase 1999-2023 -