SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG3420_complete:A_BomoMSG_c13600_g1_i1
Scaffold_idBomo_Chr9
NCBI non-redundant
(nr)		DnaJ_(Hsp40)_homolog_2_[Bombyx_mori]
Ontology
GO:0000151 C ubiquitin ligase complex
GO:0001664 F G protein-coupled receptor binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005783 C endoplasmic reticulum
GO:0005829 C cytosol
GO:0006457 P protein folding
GO:0006986 P response to unfolded protein
GO:0007283 P spermatogenesis
GO:0009408 P response to heat
GO:0016020 C membrane
GO:0030317 P flagellated sperm motility
GO:0030521 P androgen receptor signaling pathway
GO:0030544 F Hsp70 protein binding
GO:0031072 F heat shock protein binding
GO:0031397 P negative regulation of protein ubiquitination
GO:0031625 F ubiquitin protein ligase binding
GO:0042769 P obsolete DNA damage response, detection of DNA damage
GO:0043065 P positive regulation of apoptotic process
GO:0043066 P negative regulation of apoptotic process
GO:0043231 C intracellular membrane-bounded organelle
GO:0043508 P negative regulation of JUN kinase activity
GO:0046872 F metal ion binding
GO:0048471 C perinuclear region of cytoplasm
GO:0050750 F low-density lipoprotein particle receptor binding
GO:0051082 F unfolded protein binding
GO:0051087 F chaperone binding
GO:0051223 P regulation of protein transport
GO:0055131 F C3HC4-type RING finger domain binding
GO:0070062 C extracellular exosome
GO:0070585 P protein localization to mitochondrion
GO:0098554 C cytoplasmic side of endoplasmic reticulum membrane
GO:1901998 P toxin transport
RNA-seq EntryA_BomoMSG_c13600_g1_i1
Sequence
(Amino Acid)
MVKETTYYDILGVKPNCTTDELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSNPDK
RRIYDQGGEQALKEGGGSGGGFSSPMDLFDMFFGGGFSGGRRRKERKGKDVIHQLSVTLE
ELYCGTVRKLTLQKNVICEKCEGRGGKKGAVQTCPVCRGSGMQVQIQQLGPGMIQQIQTV
CCECRGQKEIVDPKDRCKVCEGRKIVRDRKILEVHVDKGMVDGQKIVFSGEGDQEPNLEP
GDLIIVLDEKEHGIFKRSGNDLILRMNIELVEALCGFQKVIRTLDERDIVITVMPGEVTK
HGEVKCVLNEGMPMYKNPFEKGQLIVQFIVNFPSRVPPELIPALENCLPARPRVEIPELA
EECQLMDFVPEQEMRRDRQRGNAYDEDDEHPGLNRVQCATS
*(133 a.a.)

- SilkBase 1999-2023 -