SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG3111_5prime_partial:A_BomoMSG_c12854_g1_i1
Scaffold_idBomo_Chr17
NCBI non-redundant
(nr)		LOW_QUALITY_PROTEIN:_chaoptin_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0001502 P cartilage condensation
GO:0001568 P blood vessel development
GO:0001701 P in utero embryonic development
GO:0001822 P kidney development
GO:0001889 P liver development
GO:0001892 P embryonic placenta development
GO:0002133 C polycystin complex
GO:0005262 F calcium channel activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005929 C cilium
GO:0006611 P protein export from nucleus
GO:0006807 P nitrogen compound metabolic process
GO:0006816 P calcium ion transport
GO:0007050 P regulation of cell cycle
GO:0007156 P homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007160 P cell-matrix adhesion
GO:0007161 P calcium-independent cell-matrix adhesion
GO:0007204 P positive regulation of cytosolic calcium ion concentration
GO:0007259 P receptor signaling pathway via JAK-STAT
GO:0007507 P heart development
GO:0009653 P anatomical structure morphogenesis
GO:0009986 C cell surface
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016323 C basolateral plasma membrane
GO:0016328 C lateral plasma membrane
GO:0016337 P cell-cell adhesion
GO:0018105 P peptidyl-serine phosphorylation
GO:0019901 F protein kinase binding
GO:0019904 F protein domain specific binding
GO:0021510 P spinal cord development
GO:0021915 P neural tube development
GO:0030010 P establishment of cell polarity
GO:0030155 P regulation of cell adhesion
GO:0030246 F carbohydrate binding
GO:0030660 C Golgi-associated vesicle membrane
GO:0031512 C motile cilium
GO:0031659 P obsolete positive regulation of cyclin-dependent protein serine/threonine kinase activity involved in G1/S transition of mitotic cell cycle
GO:0032092 P positive regulation of protein binding
GO:0034405 P response to fluid shear stress
GO:0036303 P lymph vessel morphogenesis
GO:0042994 P cytoplasmic sequestering of transcription factor
GO:0042995 C cell projection
GO:0043588 P skin development
GO:0044325 F transmembrane transporter binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048565 P digestive tract development
GO:0048754 P branching morphogenesis of an epithelial tube
GO:0048806 P genitalia development
GO:0050982 P detection of mechanical stimulus
GO:0051216 P cartilage development
GO:0060170 C ciliary membrane
GO:0060236 P regulation of mitotic spindle organization
GO:0060428 P lung epithelium development
GO:0060674 P placenta blood vessel development
GO:0061136 P regulation of proteasomal protein catabolic process
GO:0070062 C extracellular exosome
GO:0070588 P calcium ion transmembrane transport
GO:0072001 P renal system development
GO:0072164 P mesonephric tubule development
GO:0072177 P mesonephric duct development
GO:0072205 P metanephric collecting duct development
GO:0072218 P metanephric ascending thin limb development
GO:0072237 P metanephric proximal tubule development
GO:0072287 P metanephric distal tubule morphogenesis
GO:0072372 C cilium
RNA-seq EntryA_BomoMSG_c12854_g1_i1
Sequence
(Amino Acid)
QLGIDISHNQLSTLNPAIFYPNFTSWSQVATKLLSGGLILTGNPLECECELAWLGAWLRR
WLQENEAGAELRRAVREASCKDQLGRRIPLLQLRADEAECHASALSSDAQLNHKKMLHTF
IAAIWILIFR
*(42 a.a.)

- SilkBase 1999-2023 -