SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG3046_complete:A_BomoMSG_c12663_g1_i1
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)		derlin-2_[Bombyx_mori]
Ontology
GO:0001967 P suckling behavior
GO:0005769 C early endosome
GO:0005770 C late endosome
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0008284 P positive regulation of cell population proliferation
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030176 C integral component of endoplasmic reticulum membrane
GO:0030307 P positive regulation of cell growth
GO:0030433 P ubiquitin-dependent ERAD pathway
GO:0030968 P endoplasmic reticulum unfolded protein response
GO:0030970 P retrograde protein transport, ER to cytosol
GO:1904153 P negative regulation of retrograde protein transport, ER to cytosol
RNA-seq EntryA_BomoMSG_c12663_g1_i1
Sequence
(Amino Acid)
MAPYLPWVLLGFSVLLGNAISVDLVGMAIGHIYFFLEDVLPRQRNGERLLKTPNFLKKLF
DPRPEEPEYVHLPELDNVRPGGYEWRHPYPREEQNGQVQ
*(32 a.a.)

- SilkBase 1999-2023 -