SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG2978_3prime_partial:A_BomoMSG_c12389_g1_i1
Scaffold_idBomo_Chr16
NCBI non-redundant
(nr)		coronin-6_isoform_X3_[Bombyx_mori]
Ontology
GO:0000147 P actin cortical patch assembly
GO:0001755 P neural crest cell migration
GO:0001932 P regulation of protein phosphorylation
GO:0001933 P negative regulation of protein phosphorylation
GO:0003779 F actin binding
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005925 C focal adhesion
GO:0006909 P phagocytosis
GO:0010632 P regulation of epithelial cell migration
GO:0010633 P negative regulation of epithelial cell migration
GO:0010762 P regulation of fibroblast migration
GO:0015629 C actin cytoskeleton
GO:0016020 C membrane
GO:0016328 C lateral plasma membrane
GO:0016600 C flotillin complex
GO:0030027 C lamellipodium
GO:0030036 P actin cytoskeleton organization
GO:0031982 C vesicle
GO:0042995 C cell projection
GO:0044387 P negative regulation of protein kinase activity by regulation of protein phosphorylation
GO:0045184 P establishment of protein localization
GO:0048365 F small GTPase binding
GO:0051015 F actin filament binding
GO:0051893 P regulation of focal adhesion assembly
GO:0051895 P negative regulation of focal adhesion assembly
GO:0090630 P activation of GTPase activity
GO:1900024 P regulation of substrate adhesion-dependent cell spreading
GO:1900025 P negative regulation of substrate adhesion-dependent cell spreading
GO:1900027 P regulation of ruffle assembly
GO:2000394 P positive regulation of lamellipodium morphogenesis
RNA-seq EntryA_BomoMSG_c12389_g1_i1
Sequence
(Amino Acid)
MSFRVVRSSKFRHVYGQALKREQCYDNIRVSKSSWDSTFCAVNPKFLAIIVESAGGGAFI
VLPHNKVGRIPADHPLVGGHKGPVLDIAWCPHNDNVIASGSEDCVVKVWQIPDGGLSRTL
TEPVVDLVYHQRRVGLVLWHPTAQNVLLTAGSDNQIAIWNVGTGEIGRA
(55 a.a.)

- SilkBase 1999-2023 -