| Name | O_BomoMSG289_internal:A_BomoMSG_c1386_g1_i1 |
| Scaffold_id | Bomo_Chr19 |
NCBI non-redundant
(nr) | centromere-associated_protein_E_isoform_X2_[Bombyx_mori] |
| Ontology |
| GO:0000132 |
P |
establishment of mitotic spindle orientation |
| GO:0000139 |
C |
Golgi membrane |
| GO:0000922 |
C |
spindle pole |
| GO:0005198 |
F |
structural molecule activity |
| GO:0005515 |
F |
protein binding |
| GO:0005634 |
C |
nucleus |
| GO:0005654 |
C |
nucleoplasm |
| GO:0005694 |
C |
chromosome |
| GO:0005737 |
C |
cytoplasm |
| GO:0005813 |
C |
centrosome |
| GO:0005815 |
C |
microtubule organizing center |
| GO:0005819 |
C |
spindle |
| GO:0005829 |
C |
cytosol |
| GO:0005856 |
C |
cytoskeleton |
| GO:0005874 |
C |
microtubule |
| GO:0005876 |
C |
spindle microtubule |
| GO:0005938 |
C |
cell cortex |
| GO:0006997 |
P |
nucleus organization |
| GO:0007049 |
P |
cell cycle |
| GO:0007067 |
P |
mitotic cell cycle |
| GO:0008017 |
F |
microtubule binding |
| GO:0016363 |
C |
nuclear matrix |
| GO:0030425 |
C |
dendrite |
| GO:0043025 |
C |
neuronal cell body |
| GO:0045177 |
C |
apical part of cell |
| GO:0051301 |
P |
cell division |
| GO:0051321 |
P |
meiotic cell cycle |
| GO:0060487 |
P |
lung epithelial cell differentiation |
| GO:0061673 |
C |
mitotic spindle astral microtubule |
| GO:0070062 |
C |
extracellular exosome |
| GO:0072686 |
C |
mitotic spindle |
| GO:0097431 |
C |
mitotic spindle pole |
|
| RNA-seq Entry | A_BomoMSG_c1386_g1_i1 |
Sequence
(Amino Acid) | DNRWVNELSATPRREPPPPPGVRLSELRWRNSLCPPHLKSSYPAETQFASALDEEDIKCV
GANTTCGKQQRKEVGITAYKKPGPPTPSKQAGRLSATDSELRESLRVEADPQPSSRRT
(38 a.a.) |
