SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG27_internal:A_BomoMSG_c136_g1_i1
Scaffold_idBomo_Chr9
NCBI non-redundant
(nr)		uncharacterized_protein_LOC101740358_isoform_X1_[Bombyx_mori]
Ontology
GO:0001525 P angiogenesis
GO:0005102 F signaling receptor binding
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0005737 C cytoplasm
GO:0007155 P cell adhesion
GO:0009986 C cell surface
GO:0015630 C microtubule cytoskeleton
GO:0016337 P cell-cell adhesion
GO:0030054 C cell junction
GO:0036458 F hepatocyte growth factor binding
GO:0042325 P regulation of phosphorylation
GO:0042802 F identical protein binding
GO:0045202 C synapse
GO:0048870 P cell motility
GO:0051965 P positive regulation of synapse assembly
GO:0060076 C excitatory synapse
GO:0090050 P positive regulation of cell migration involved in sprouting angiogenesis
GO:0097060 C synaptic membrane
RNA-seq EntryA_BomoMSG_c136_g1_i1
Sequence
(Amino Acid)
DKEPPRVDRCPGDLWVIAKNGSSIVNWDAPVFSDNVGVAKVVEKSGHKPGENLAWGAYDI
AYIAYDAVGNAATCTFKITVLSEFCPPLPDPLGGYQSCRDWGA
(33 a.a.)

- SilkBase 1999-2023 -