SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG2724_internal:A_BomoMSG_c11648_g1_i2
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)		potassium_voltage-gated_channel_protein_Shab_isoform_X5_[Helicoverpa_armigera]
Ontology
GO:0001508 P action potential
GO:0005216 F ion channel activity
GO:0005244 F voltage-gated ion channel activity
GO:0005249 F voltage-gated potassium channel activity
GO:0005251 F delayed rectifier potassium channel activity
GO:0005267 F potassium channel activity
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006813 P potassium ion transport
GO:0007268 P chemical synaptic transmission
GO:0008016 P regulation of heart contraction
GO:0008076 C voltage-gated potassium channel complex
GO:0008345 P larval locomotory behavior
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0034765 P regulation of ion transmembrane transport
GO:0048812 P neuron projection morphogenesis
GO:0051260 P protein homooligomerization
GO:0055085 P transmembrane transport
GO:0060025 P regulation of synaptic activity
GO:0071805 P potassium ion transmembrane transport
RNA-seq EntryA_BomoMSG_c11648_g1_i2
Sequence
(Amino Acid)
RLGRLRDCNTHEAITELCDGYSLQDNEYFFDRHPKSFSSILNFYRTGKLHLVDEMCVLAF
SDDLEYWGVDELYLESCCQHKYHQRKEHVHEEMRKEAESLRQREEEEFGQGTCAQYQKWL
WDLLEKPTTSIAARVIAVISILFIVLSTIGLTLNT
(50 a.a.)

- SilkBase 1999-2023 -