SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG2722_3prime_partial:A_BomoMSG_c11643_g1_i1
Scaffold_idBomo_Chr3
NCBI non-redundant
(nr)
protein_MCM10_homolog_[Bombyx_mori]
Ontology
GO:0003674 F molecular_function
GO:0003682 F chromatin binding
GO:0003688 F DNA replication origin binding
GO:0003697 F single-stranded DNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005656 C nuclear pre-replicative complex
GO:0006260 P DNA replication
GO:0006267 P pre-replicative complex assembly involved in nuclear cell cycle DNA replication
GO:0006270 P DNA replication initiation
GO:0016321 P female meiosis chromosome segregation
GO:0030261 P chromosome condensation
GO:0031298 C replication fork protection complex
GO:0035214 P eye-antennal disc development
GO:0042023 P DNA endoreduplication
GO:0045678 P positive regulation of R7 cell differentiation
GO:0045931 P positive regulation of mitotic cell cycle
GO:0046872 F metal ion binding
GO:0070868 P obsolete heterochromatin organization involved in chromatin silencing
GO:1901693 P negative regulation of compound eye retinal cell apoptotic process
RNA-seq EntryA_BomoMSG_c11643_g1_i1
Sequence
(Amino Acid)
MDEKDELSQLEELLSADFGENTEMNAQNNTKEVDIFQQTTNLRSEMPSSSTAEVPSIVHN
GDTDSSDDEEKRDYAERKYNDYGSQVKKSLDKIEQDQINQRLDFESRLR
(35 a.a.)

- SilkBase 1999-2023 -