SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG2643_internal:A_BomoMSG_c11507_g1_i1
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)		PAX3-_and_PAX7-binding_protein_1_[Bombyx_mori]
Ontology
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001078 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0005829 C cytosol
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007517 P muscle organ development
GO:0008134 F transcription factor binding
GO:0014842 P regulation of skeletal muscle satellite cell proliferation
GO:0031062 P positive regulation of histone methylation
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:2000288 P positive regulation of myoblast proliferation
RNA-seq EntryA_BomoMSG_c11507_g1_i1
Sequence
(Amino Acid)
LAPYVRHEMILWNPLADEDNEDYERMDWYKCLMMYGVRNEKTSSDSSDSDMEHDGHTVVT
ESSVRDDIDLMLVPTIVGRVVIPKLTELVEQAWDPMCVRACVR
(33 a.a.)

- SilkBase 1999-2023 -