| Name | O_BomoMSG2545_internal:A_BomoMSG_c11296_g1_i1 |
| Scaffold_id | Bomo_Chr1 |
NCBI non-redundant
(nr) | LOW_QUALITY_PROTEIN:_chondroitin_sulfate_proteoglycan_4_[Bombyx_mori] |
| Ontology |
| GO:0001525 |
P |
angiogenesis |
| GO:0004871 |
F |
obsolete signal transducer activity |
| GO:0005518 |
F |
collagen binding |
| GO:0005886 |
C |
plasma membrane |
| GO:0005887 |
C |
integral component of plasma membrane |
| GO:0006954 |
P |
inflammatory response |
| GO:0007165 |
P |
signal transduction |
| GO:0007275 |
P |
multicellular organism development |
| GO:0009986 |
C |
cell surface |
| GO:0010226 |
P |
response to lithium ion |
| GO:0010977 |
P |
negative regulation of neuron projection development |
| GO:0016020 |
C |
membrane |
| GO:0016021 |
C |
integral component of membrane |
| GO:0016322 |
P |
neuron remodeling |
| GO:0016324 |
C |
apical plasma membrane |
| GO:0016477 |
P |
cell migration |
| GO:0030154 |
P |
cell differentiation |
| GO:0031258 |
C |
lamellipodium membrane |
| GO:0042995 |
C |
cell projection |
| GO:0048771 |
P |
tissue remodeling |
|
| RNA-seq Entry | A_BomoMSG_c11296_g1_i1 |
Sequence
(Amino Acid) | TDTPQIQVVQGENYTITKNDLLTEDADTSPSGILYDIISGPTQGRIVMIDRNQTVDEAQS
INKFTQDDINSGRIIYEHSGILQTATFYFRVWDGQFKPTYTVFTIDVVPVILNATSLHPI
HLQQGSNVAAITPEQIYVETNA
(46 a.a.) |
