SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG2486_internal:A_BomoMSG_c11142_g1_i1
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)
dorsal-ventral_patterning_protein_Sog_isoform_X2_[Bombyx_mori]
Ontology
GO:0005518 F collagen binding
GO:0005886 C plasma membrane
GO:0007275 P multicellular organism development
GO:0007313 P maternal specification of dorsal/ventral axis, oocyte, soma encoded
GO:0007354 P zygotic determination of anterior/posterior axis, embryo
GO:0007362 P terminal region determination
GO:0007378 P amnioserosa formation
GO:0007398 P ectoderm development
GO:0008083 F growth factor activity
GO:0008293 P torso signaling pathway
GO:0008586 P imaginal disc-derived wing vein morphogenesis
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030509 P BMP signaling pathway
GO:0030510 P regulation of BMP signaling pathway
GO:0030511 P positive regulation of transforming growth factor beta receptor signaling pathway
GO:0030512 P negative regulation of transforming growth factor beta receptor signaling pathway
GO:0035271 P ring gland development
GO:0040008 P regulation of growth
GO:0061328 P posterior Malpighian tubule development
RNA-seq EntryA_BomoMSG_c11142_g1_i1
Sequence
(Amino Acid)
ICNSIDSALSGRIDRYPALSSEMFTSLLEPENPPTTFSQATCRGSKDLDHEEGWWGGTAV
ITSVAGAAPSLYMAIVFNGIFPKTVNTSDLVRVVLTLPDKNQTIIDQ
(34 a.a.)

- SilkBase 1999-2023 -