SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG2416_5prime_partial:A_BomoMSG_c10908_g1_i2
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)		polyhomeotic_[Bombyx_mori]
Ontology
GO:0000070 P mitotic sister chromatid segregation
GO:0001047 F core promoter sequence-specific DNA binding
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0006342 P heterochromatin assembly
GO:0007275 P multicellular organism development
GO:0008270 F zinc ion binding
GO:0016458 P obsolete gene silencing
GO:0021954 P central nervous system neuron development
GO:0030708 P germarium-derived female germ-line cyst encapsulation
GO:0030713 P ovarian follicle cell stalk formation
GO:0035075 P response to ecdysone
GO:0035102 C PRC1 complex
GO:0035186 P syncytial blastoderm mitotic cell cycle
GO:0044547 F DNA topoisomerase binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0051087 F chaperone binding
RNA-seq EntryA_BomoMSG_c10908_g1_i2
Sequence
(Amino Acid)
EPPRKKQMLEGGASLPRISSSNDNHVSESSTQNANVKAEASSNVEMADSQPTSADSAQAK
IPNAYKWTVAEVCEFIRNIPGCAGYADEFLMQEVDGEALLLIKPEHLVMALSMKLGPALK
IVACIDSLRPESEQNLHDHD
*(46 a.a.)

- SilkBase 1999-2023 -